SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT20366 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20366
Domain Number 1 Region: 192-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-21
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 51-133
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-18
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 3 Region: 400-496
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.33e-17
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 4 Region: 609-712
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000122
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT20366
Sequence length 918
Comment pep:novel supercontig:GCA_000347335.1:Scaffold27867:53883:61137:1 gene:F775_10093 transcript:EMT20366 description:""
Sequence
MSKITGVVTASAANPFKDVRAAMHIIIGVIWMIPRSISSSAWLAISKKKWQVLAIPQKFV
QNFKGQISEVIKLEAPDGNIYNVQAIKDLNKIVLGSGWGVFVRFYELKAGYFLVFRYIGD
SHFKVLIFDFASCCEKEVFHVLMNCGPNAQEKDTRLDRSLLGERRCQNGGSSNSESHRRC
EHCDVHFYWHHMDDRQKHFLRFMVGDFLHEMNIPEKFVNNFRGRISKVMKLEAPDGNVYN
IQVTNDLNKITLRSGWAAFASAYELKEHDLLVFSYTGNSHFRVLIFDPSGCEKELFRIVM
NHTPNVQKGGISHDQLFLKETRRRDGGSRDNNPRKTKKMTLLDSPSPKSAEGVTSPEDTM
NSSGPPETTEPRYVLATGCNLTTAQKAQIDTLVKKIRPVIPFYITAMNKTSLSGSLVICK
DYAAKYLPHEDQFITLCHPRKSNIWLDNLKVTTDGSGMLSAGWSCFVLHNELRESDVCVF
EVSKSAGEMTMVVHSLEGGHHLQGKEPESQNKCDFPVKGKAIKEAESDHKNAESKSNYYY
SKYAKGLNGEELEEIFRSALIQQGNVGKAIKEAESDHKHAESKSNYYYSKYAKGLNGEEL
EEIFRSALIQQGNVVYVTILGKNQVRIKNNLLTFPEKFAAKHLVERSHDILLLRPNRSET
WCARYYYHPEKQGFSYSSWTKFVRDNKLREGHVCVFELIKGVSKAMMIVHVFTKVDGSQR
NLSLLASTWYSMEVSDYHANLVIHSPSNHESKTFIGVLRHALSLNVNKTLRYMIGHVFMS
CPNLSITIPKSTSSRRKIEQGGDTDRLREAGGRRDLHILYTGFQARRDALRGDHRRILVG
TMPGLAALVVAPQLAPFSTTAAAHHRRRTGLSREAGNLLVRSSLVILITLLSLVTLGHVG
EVEPRHPHQAISIHGQAY
Download sequence
Identical sequences R7WCQ0
EMT20366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]