SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT21044 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT21044
Domain Number 1 Region: 300-419
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000942
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 107-208
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000126
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT21044
Sequence length 421
Comment pep:novel supercontig:GCA_000347335.1:Scaffold26251:116890:118865:-1 gene:F775_02019 transcript:EMT21044 description:"B3 domain-containing protein "
Sequence
MSNHCECCERMIRFIRETCCAGTKAASDVTKPSSRYVDNSSSSHNGTTQSSAGEGSDSDG
SQKESSYSHQKSAKKAAISDSSEELSGWCYLTEAQKVKIHALVEKIRPEIPVLVVQMKKT
SANIGNLVIRKDYALKYFPCEATDIILQLPGKNKEWRCKLQIRPSGMVGAGRRNLYLGSF
VHDNCVQEGDICLFQPLAKVKEEKFTVIVHLLHKEGIRRSSGGRADMAHTAAERRICAKT
ALTASVKEEPATDGEDTLSLGSEEDGGNSEGASETPFILPDRPFVTPAQEQKVREKVEAI
DSTVPVYVAILNRSNVRYDNFTTFLTFGAKYASRYLNKNYGAGHHGKKNMISLVLQREGK
SRTWNTELQRRVDRTSILKGWASFARGNRLREGDLCLFKLMESVEPLKMMVYIIRREKCL
A
Download sequence
Identical sequences M8BGD9
EMT21044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]