SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT21328 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT21328
Domain Number 1 Region: 239-521
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-58
Family G proteins 0.08
Further Details:      
 
Domain Number 2 Region: 1530-1796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.55e-58
Family Nitrogenase iron protein-like 0.088
Further Details:      
 
Domain Number 3 Region: 941-1131
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.9e-31
Family Protein kinases, catalytic subunit 0.0046
Further Details:      
 
Domain Number 4 Region: 1862-2238
Classification Level Classification E-value
Superfamily L domain-like 9.18e-23
Family Polygalacturonase inhibiting protein PGIP 0.017
Further Details:      
 
Domain Number 5 Region: 1146-1278
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000000128
Family MSP-like 0.01
Further Details:      
 
Domain Number 6 Region: 571-875
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000952
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT21328
Sequence length 2357
Comment pep:novel supercontig:GCA_000347335.1:Scaffold25563:17689:32419:-1 gene:F775_00445 transcript:EMT21328 description:"Disease resistance protein RPP13 "
Sequence
MAMCKKTALRDQRSPNLTSLSPLTKHRMPGSSLQWESDRTLQQDMLYQSTHRVLRFSSSF
ISNSTTNSSATARKHTPPPRPSHEGRHDPLDQEAQRLLVDEYKLEKRVRNGIKSLITELE
MMHAVLRKIGAKPPEQFDEQVLIWAGKVRDLSYHMEDAVDAFLVRVEDVGHDRGSNNMKN
RVKKFLKRATKLFTKGKALHQISNDIDEAQRLSKELGELRQKYMSDANANSNGDAIDPRL
KAVYKDVTELIGIDHIRDELIEKLCDCDERSKGQLRTMSIVGFGGLGKTTLVKAVYDKIK
VQFDSVAFVSVSRNPDMAKIFKKVLYKLDKTKYATINEAARDNEQLIDEPTMFLQDKRYL
IVIDDIWDEKAWELIKCAFPDNCLGSRVMTTTRIASISKVCCSSGDDIVYQMKPLPDDES
ERLFYQRIFPQGSKCPHELEEVSRKILKKCGGVPLAIITIASILASNGQDQHIKPKYHWD
NILGSIGRGLAEGDSAKDMQRILSFSYYDLPSHLKTCLLYLCIFLEDFEIRRDRLIWMWI
AEGFVQGGKKESGLFELGESYFNELANRNLIQPIHVDATGKAEACRVHDMVLDLLCSLSS
EQNFATILDGTQQSKPISHSKSRILSFQNSMSEPTTHQVDARSMPQVRKATVFGDTEFSK
KWIKCSSDIPSSVVCLRRLIFLDAGYAVLPVGIGNLTSLEELAGKLVDVKDLGQLVELRV
LDLYWDGNDESLCNSLVVSLGNMQKMQTLRINGQRGAMFDDCWDGFVPTPQLCVLDFDRC
TTTLPSGQSAARCRHSDPCQFLGKLPSLRCLMLCSSKIQHTRVESFVVGASAFPCLRECN
LWHFLMGPSMFPRGAMPRLEILRFEARALDIAGGDQYVGMEHLTSLQRVDIGLRLEKGSS
SDKCKEEADVVLRHAADIHPNRPIVDIIRDEEPKDLPLALLQHITNDFCEERKIGQGGFG
DVYKTRIQEAGSEEIKLANVRERLLCFEYISNGSLDKHITDELRGLEWETRYGIIIGICN
DFGLSRPNESSHTIGQRFGTRGYLAPEYENAGKTLVKSDIYSLGAIIIELVTGCMGAPDK
INVLRRWRHRWSKPPTLLQYQQVTRCIDIAARCRQQEPGLRPSISEIISSLIGPESTDVH
TGQVSPYFDEDDMLGIKPLELQLSSELKEEISCFTVELTNDTRSCIAFNIQLPSRQQYSA
QPDIGIVQPQSKYGVKITVQARDAHEYDHADEFIMQSMKLSDGLRDMVFTESMFHEEAGK
VVDEVNLMVVYAPTKPQENCKSREDTNTPEEVLEVINLTRLNVFVRKSRIVDSASGKGKL
VSNENAETSLVRHKDINSSTREHYTEQTERYKFYQPRSFSCHYPTNTTYLGKGSRAVDVA
RGAMGSLLDKLGKLVKEDYNLERSMKRDIESFSEDLAKIHKDLPKLEKLDGLKIWVDEVR
ELSYNIEDMVDSFLLHVELDSSSSGFREFPREGLKFLENDMITHRPIGDVIRDIKNHVQA
VADRQKKYNFSVNDVIADPTAKAPIDPRMAKYINKKQLVGIEAPTDELIRLFGEDGGVSK
QELKIVSIVGLGGLGKTTLARAVYDKLKAQYHCRAFVSVGQNPDVKKVLMNILFALGKKF
NDLDVLQLIEELQKLLEDRRYFIVIDDIWDSEAWDPIQSAFPENSLGSRVITTTRIHPVA
LATCSAKSKFVYRMKSLSPEDSRRLFLRRIFGSEEASPDTPREEEISVDILKKCGGMPLA
IISIASLLAGEPASTWDYVRKTMGAMTDGDDVEKMKQILDLSYIHLPDHLKTCLLYVCMY
PEDREIDKFDLLRQWVAEGFVITNGRLDAVDLAEKYFKELINMCMLEPGKIDDYNNEVLS
CRVHDIILDLMRSKSSKENFIHVIDGSKDETGQIRRVAFHYNDKEDTGISGSINKGSLSH
VRSVLLRRTSLVPRFQEFQYVRVLHLELELSSMDLVDLTGINRLFLLRYLKVAPLRPFGY
SLKLPNKIGGLQQLETMDLDYASLEKYPSDIASLPWLSHLSSRANAEGGIALPDRIDRLT
SLCTLEGVCIYRSSVENIKGLGKLTNLRKLAICSAKFRQTMEEEEEIMRVDALHSSICML
ASNLRILTFGISSEVSMLDVGCWSSSSPFPQVSHIRELNLLCCEFEKCPEWIGQLHHLYK
FLISVKEVADGFSIVARLPSLAYFKLVTFVKEEKEESVVIPGRGAFQALKHLIFHCEKVS
LTFEEGAMPKLEKLDMQLRWDMTCEFLPVGIDHLQAGTLKEIWLRVHWHPSCPVEGSQDF
DDDVCSAKCNDNCEHKEPVRRLLEGAFKPHHHTADISISFVDYCYVGDEFDEEDGDNELT
STDSSTSDEEDGDNESD
Download sequence
Identical sequences M8BHW2
EMT21328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]