SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT21381 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT21381
Domain Number 1 Region: 53-320
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-57
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 2 Region: 373-487
Classification Level Classification E-value
Superfamily PapD-like 0.000000948
Family MSP-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT21381
Sequence length 524
Comment pep:novel supercontig:GCA_000347335.1:Scaffold25461:46547:51027:-1 gene:F775_06780 transcript:EMT21381 description:"Cysteine-rich receptor-like protein kinase 26 "
Sequence
MAGSVVIVALLLKAKDRRCSSYLQGQCSRPRRSRSHRGAGRTGILNSLVLPVGVLKDGEK
IAVKLLHPLPGLEDSDQQFQNEFDNLVKLRHQNIVHLVGYCYEIQKRYVDYNGRNIFAED
IRRVLCFEYMQKGSLDKYLSDECSGHGWNTRYAIIRGICKGLKYLHEELESPIYHLDLKP
ANVLLDEDMTPKIADFGLSRFFFGEEQTQVTKTSMGTLGYLPPEYIERGVISNKFDIFSL
GVVIIKIMTGPKGYSRSAEMLSHQFSELVNKNWRSRFHSTSLNMVQSYLEQVKTCIEIAL
SCVEADRQKRPDIGYIVNKLDETEMLIQLQHALSIDAGSSLDQISPDMPTGSGLLDASPK
IESGCLHASPNIEGGLLDIHPCQLDFLFEPNKLISCPLRLTNNLGDQHVAFRCVPKTPEI
YLDGLSQFQGVLPPRSTCTYVLTMEMQQHPPTNMDALSLILESCVVPQDIGDIDDYMSRQ
GPGHAVRLMAICGPAGKTVISEIIYCRDEFRETLSMDVHPTEPW
Download sequence
Identical sequences M8CDZ5
EMT21381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]