SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT21562 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT21562
Domain Number 1 Region: 171-314
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.57e-39
Family Mannose-binding lectins 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT21562
Sequence length 315
Comment pep:novel supercontig:GCA_000347335.1:Scaffold25041:189010:190262:1 gene:F775_15045 transcript:EMT21562 description:"Uncharacterized protein "
Sequence
MAATNPSYYQSGVCQDIKQKEHLFHLYMNQIFDGPGVTNANQVTVANPSGQLLGFGHTVA
NDWTIRDGPAADANLVARARGMHMGAGKVDENWLFCHNILFTDTRFKGSSLKVLGDFVGN
NSEWAIVGGSGEFAYAQGVVVAKVIQTVPPTPGRTWELRISAFCLCIPKVTPVTKMGPWG
GDGGTSFDITELPRSLQTVTIRCGDVINSVMFSYTDQAGQKKTVGPWGGDGALTATITLA
PSEFIKQVLGTTGTVGGETVVTSLTLVSSVTTYGPFGKANGTPFSSQVPDGNNVGGFYAR
AGRSVNALGVYACPI
Download sequence
Identical sequences A0A1D5T1B2 M8C3A6
EMT21562 XP_020160691.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]