SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT21643 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT21643
Domain Number 1 Region: 299-501,535-649
Classification Level Classification E-value
Superfamily DNase I-like 7.32e-45
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00011
Further Details:      
 
Domain Number 2 Region: 8-60,101-132,198-301
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.55e-17
Family WD40-repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  EMT21643
Domain Number - Region: 780-808
Classification Level Classification E-value
Superfamily PapD-like 0.0175
Family MSP-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT21643
Sequence length 1000
Comment pep:novel supercontig:GCA_000347335.1:Scaffold24783:11:8803:1 gene:F775_12456 transcript:EMT21643 description:"Type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3 "
Sequence
MFKEALSWQAHSRTPVLSMVVTSYGEIWSGTEGGVIKAWPWDVIAKSLSLTPEEKYMASC
LVENAYIDLRNYVTVGTMFSLPTTDVKHMLADHCRAKVWSLTSMTFALWDARTRELLKVF
GMDGQVESARLEPLVMPEQFIEEEIKVKPTKKEKNQGSVTFLKKSWNALIGAGGAVRRVA
TKGTFVEDNRRTETVAQAMDGAIWSGCTDGSIIMWDGNGNWLKEFSYHNSSVQCIKALGG
KVWVGYASGTVQVMDVEGNPLGGWTGHSCPVIQMAIGGSYIFTLAHHGGIRGWPLTSPGP
LDDILRTELAKRELSYTRVENIKMLVGTWNVAQEKASPESLWSWLGTASSDVGLVVVGLQ
EVEMGAGVLAMAAAKESVGLEGSANGQWWIDNIGKALDEGISFHRVGSRQLAGLLIAAWA
RTDLKPHIGDVDAAAVPCGFGRAIGNKVLRRNNFIGGVGLKMRVYDRRICFVNNHFAAHL
ENVTRRNADFDHIYRTMNFNKSHGSAASDTSVQLHKAVNILTYWQANGNQPDEDRPELAE
ADMVVFLGDFNYRLYGITYDEARDMVSQRSFDWLRERDQLRAEMKAGNVFQGMREGFIRF
PPTYKFQRHQPGLADSDHKPVNCTFSVDLARVNELIRRQEYGKIIESNEKLHCLLQESHH
VPDTIISTNNIILENEETVVLRITNNCGSKKSAFEILCEGQSTSKQDGTKTDFIARASFG
LPHWLEETKLRELWDLSFTCMLDPSLSIIYLRTTPDVSPFQELKIRRNTTYITLHQIDME
VQPSIGLIEPGETMEVNVHHENYYTQEEFVDGVVQGGWCELTRDKEAVLLVNVTGSTSTE
TVTHRINVRHCCAASSPPPPVSLLAIAAPPGDAPSSEGLTERSSRKSQSNHLQRSDAHFG
ASEVHDLHRLRNMNVQWTDESGRIFHVHGMSTYAAGVDGPRIAATGSQLSDRCAEADWGE
KAETAMESGARRIKAANGKRTTQRHRTAISMSRWVAAAYR
Download sequence
Identical sequences M8BIR5
EMT21643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]