SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT22028 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT22028
Domain Number 1 Region: 318-618
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-63
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 25-246
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-45
Family Protein kinases, catalytic subunit 0.0009
Further Details:      
 
Domain Number 3 Region: 813-986
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.6e-30
Family WD40-repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 641-755
Classification Level Classification E-value
Superfamily PapD-like 0.000000000942
Family MSP-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT22028
Sequence length 1056
Comment pep:novel supercontig:GCA_000347335.1:Scaffold23969:79748:91116:1 gene:F775_02478 transcript:EMT22028 description:"Cysteine-rich receptor-like protein kinase 41 "
Sequence
MPPSTSLQVVAGSETMPPRRKKTDVGQGVYENGGEIAVKILNNIPVGLDDTKFLKEFNNL
RGLKHQNIVELVGFCNESVEGPAMFEGKQVTAVSLRTALCFEYVSNGSLHKYISDQKTGL
NWHTRYRIIKGICEGLKYLREGLGYPVMHFDLKPDNILLDNKMMPKIADFGLSKLFGEEN
TTRAMSAVGTLKQHFLPYLACSGYWPPEYIKCQIISGEFDIFSLGVIIVKIMTGHQGYNS
TVEMMTRKSVTLVQESWKKKLRETVSPTSLEVYCNQAHVNSLFETSQKFYQDSGENSPIL
IRKNNSITIKSRSSSGNFRYAEPRAMPFSLLKVVTSDFSREELIGRGGYGGVYKGVYGDG
QIAVKLYTLKGIDNKQFQNAIEVHKKFHHENVAQLVGYCYETEEVVIPFNGKHVVVGLDI
HMAICLEYFPNGSLNRYISDVKSGLDWCMRYQIIKGLCDGLRYLHEGLESPVIHMNLKPS
NILMDEKLTPKIGDFGLARFGAGKSDRTMDMSGAREYMPPEFIEKQVISKKHDIYSLGVI
IIKLMTGVKMYLKCYDMSSEKFIELTLENWRERLQKTVDATLIEGYCEQVKKCLDIALTC
LASNRRRRPTIGDIVHTLNETETLIPQVEIILDSELLDSEDSDQLLHVHPSELYFLPAMS
SVEVPRKKVAMISSCSVQLNNKGDDRVAFMLVAKSPKRYLTKKPLCGIVPPGSTYTLTLT
MLKQQPLPSGIDGEFFTLYSLAVNEYDLQDEDVEKDSISVKYNNFFEKTKEKAGADQEVV
QEMTLKVLCCQHQEDDHVTSSSEVITTSDAQQVSSIDVHPTEPWIITTNNVGSLRSWNYK
TMLWDWSKDWECTRTFQGHIDRVMQVKFNPEDKDSFASASRDGTVKIWKLGMGQCVDKLE
GHVDHVSAANLHPELPMLITGSLDGTVRIWNSTTYKLENIIGFNLGAVYAVGCIKGSRRF
LFSIYPDASELNTYSLRSELLVAEMDVSRRILILDTSISETSNSERREYVLIQLPSHVDC
GWVSPRNSNDGTFFTLKIMLSLDIIYGVTSQTDVRA
Download sequence
Identical sequences M8BJR6
EMT22028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]