SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT22233 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT22233
Domain Number 1 Region: 209-463
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-45
Family Protein kinases, catalytic subunit 0.00091
Further Details:      
 
Domain Number 2 Region: 630-848
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-36
Family WD40-repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 482-603
Classification Level Classification E-value
Superfamily PapD-like 0.000000000016
Family MSP-like 0.01
Further Details:      
 
Domain Number 4 Region: 903-1038
Classification Level Classification E-value
Superfamily PapD-like 0.00000000314
Family MSP-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT22233
Sequence length 1043
Comment pep:novel supercontig:GCA_000347335.1:Scaffold23505:59321:72755:1 gene:F775_07149 transcript:EMT22233 description:"Putative coatomer subunit beta'-3 "
Sequence
MAASQKSTKLRANCMTRVKNERVHLLWKMRNQGQPPANDMLKYDAVTSLYRCEQSVRDAL
RSVFAGHNEILNVWKFFLGFMLNFVLCAFFMCVHRPMQRSVLPPNLHPSDSEGHKAKVED
GRAIITRARQRGALASGISAMPLCLVSSLHAMKSSFSVLDDADHMIDFEKYQWQIKLSYH
LPGAQIMDHQGCITEIELENMLFDEDLEPIALPYSLLKKITDDFSDKLEVGRGGFAVVYK
AILDNGVVAVKRLSNTYMYEEKFQGEIECLMKAKHKNIVRFLGYCSDTQGNMESYNGKWV
MADVQQRLLCFEYLPKGSLDGHITDLFGEIEWRKRYNIIKGDMMPKITDFGLSRCFEEDQ
TRVITKNVAGTMGYLAPECYCGEKIAITHKFDLYSLGVIIIEILTGKKGYQIAIENVLEI
WSNMMLDALQWEQLRVCARIGIECTDLDPGKRPASMKHIVDALAQTECSTHLSPAGGESE
LLLLQQFTLCFPFEPNKVITCPLQLTNNTDKHVAFRLTDKSMESSFIRLPLYGIVPPNTP
FTLIITTQEKEELPQKYIIDVILHNATLILEDDEYINTFQSQPDNFFREMGNAVQEVKLK
ALYTLPRHITPSLSKIILQMKSHNKYDEHMYALDTNQARQWIIIGDSNGYVGFWDYHAQA
KYGDIQVYDYEKKKMITSFRVGGGGPGELLSMAVHPNKPYLLSAGWQLKLWDWDKDWECV
HTFGDNFHSAYQVAVNPNNTIATASVDLEGDTVKIWSLDSPKSNYALSGHSGRVTCLDYF
TCHDQEFLVTGSDDQTAKIWYLQKKICVYTLEAFISPVMSVLYHTNLQTLIIGSEDGAIY
LWSTANCSVAIAKGNTVAIMDINNVDYQEQSTYCNKQPLGADTRQHAEDRASKEVSGSIN
MLPILDIHPLELCFPYHPNEPISCSLELRNNTDENVAFRLVDKSGKSPWCFTKLPLYGIV
PRRSTCNLIVTTKEEMKLKEKKDFNLVIQSSLLRDKYTMVFQNHSECDLFFEEAKEFGNM
VHEVILKAVYLRYEETPSKIVAD
Download sequence
Identical sequences M8BKC7
EMT22233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]