SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT22347 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT22347
Domain Number - Region: 574-640
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0239
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT22347
Sequence length 675
Comment pep:novel supercontig:GCA_000347335.1:Scaffold23242:40589:49564:1 gene:F775_07136 transcript:EMT22347 description:"Uncharacterized protein "
Sequence
MPRERRRGDDRPERSSLPCMPLERHRPDQGHSWFHFRLPNGQQIPVYKDRQGVLFTDHCG
PTRPVADVCNELFPGLIPDRPPPVADPESKRPEEDQKTPTPNPQYVDDLLNKAYADHKLQ
LAQRPKELLDSTTLVESSITNAASSSLPQSPSCEVPDILELELNTTHSLSSCVFSLTPTG
LLIKYFVRVDKEGRFHTYPDRGGPFQSLHEAQQAIDSHHVVGRNNLCMDGLSSREKSVRY
ALYWPHDGTRRNSAEAFAAMKTRRPKQEVVKALLDKYNEDNDLLGDLAYRLEEIVRYKPC
FDGKDCDYRSYSHLNMTIKIKGADDPRKKLYFAEVTCMRGEHEEYVLTCICAVEPDANGE
CLVCGDEMKHPIDAEYNHGRSTPIFRCCSHADAKALGEELITVHDEAWLEKEEARVRQVF
EEVAEDIKKEKAAKLAEAIKEEKAAKLAKAIKENALKEVNEATEVGTIGHGHGKSAKMGS
IIFVETSAEAAVKREREVIEKKMKLWVKAVDALNAACRDFSKYYVSKCDDDKVKLYEAKE
KNIGKLKKNQGAPPSSLPPSPSPTPSDFELIPCHVRRYVLERMDFEDHESMETKKIHLRT
HHGMDFEVNMYNSESVTHFGCPNWEAFCKMYGFYEGMLVTMDLGDPDIAQDNMDIWVLVD
TLPILLLCEFLKHSY
Download sequence
Identical sequences M8C5R4
EMT22347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]