SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT22525 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT22525
Domain Number 1 Region: 50-162
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-28
Family B3 DNA binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT22525
Sequence length 625
Comment pep:novel supercontig:GCA_000347335.1:Scaffold22841:8776:15384:-1 gene:F775_32978 transcript:EMT22525 description:"Auxin response factor 22 "
Sequence
MTENAQQCFPEGRCPGPARRLLTSKSQPSLKIDVTFKCSPNLAIPFLQVPARAKRASRAK
TLTQSDANNGGGFSVPRYCAETIFPKLDYRADPPVQTVLAKDVHGEVWKFRHIYRGTPRR
HLLTTGWSTFVNQKKLVAGDSIVFLRTEHGELCVGIRRAKRVTCGGMECISGWNAPGYGG
FSAFLKDEENKMMNGGPAGYVKGRGKVKIADVAEAATLAANSQPFEVVYYPRASTPEFVV
KAAAMQAAMRIHWCPGMRFKMAFETEDSSRISWFMGTISSVQVADPLRWPNSPWRLLQVT
WDEPDLLQNVKCVSPWLVELVSSIPPIHLGPFSPPRKKLRVPQHPDFPLDGHLFNPIFHG
NPLGPSNSPLCCYSDNNSPAGIQGARHAQFGLPLTDHQLNKLHLGLFHGGGFNRLDALTP
SSRIPKGFVLSSAPAHDSVSCLLTIGTPQSTEKSVDRKTPHIMLFGKAILTEQQMTSSGS
RETLSSGATGNSSPISTGLKAGNASDGSGSSICIGFSSQGHEASDLGLEAGHCKVFMESE
DVGRTIDLSVFGSYDELYGRLADMFGIEKEEIISHLRYRDTAGAVMHTGGLPFSDFMKVA
RRLTIISGEKGGLAKPLIECMVQRV
Download sequence
Identical sequences M8BC98
EMT22525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]