SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT22577 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT22577
Domain Number - Region: 113-200
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000334
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT22577
Sequence length 204
Comment pep:novel supercontig:GCA_000347335.1:Scaffold22754:9982:12515:-1 gene:F775_09852 transcript:EMT22577 description:"Uncharacterized protein "
Sequence
MSAQYPVPCRMVIFCNKGTLWSADLPRSRTISILFFVSLNIVFENWAIFESMKSTRTVKH
HEIFIRNAECVVLFTDLEDEAREIRRLLVKLYNHNVRTLRKIIRSTTTPDNYYVCHMTET
FATQGKRMGFHFPHMDADHGELPITTGDGTAAVTARFIKGVDKRATITEGWSDFFRQAHM
NEGQVYAFAFKCTSKGLCLIVYSI
Download sequence
Identical sequences M8C6B7
EMT22577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]