SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT22877 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT22877
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000184
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 129-214
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000667
Family B3 DNA binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT22877
Sequence length 221
Comment pep:novel supercontig:GCA_000347335.1:Scaffold22086:4874:5817:-1 gene:F775_14594 transcript:EMT22877 description:"B3 domain-containing protein "
Sequence
MPDKFAKVLAGREPREVKLREAGSGRHSLWDVKVVLDADGHMYLGRGWEQFARAHDLRLG
YILLFSFDGDAVLTVKVFDVSMCRRHYQRDDDASSGSSNDGSGSAETEVDEAPTSQFTGA
CHFLEKQQQYLNVPLEFHEAHGYAERSKVVLRMSGKSWPVTLKHTNRAGGKTRSSFRYGW
HQFLVDNRLTVGDTCFFRALRGGEDHELKVQVRKLDGSFVD
Download sequence
Identical sequences M8C787
EMT22877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]