SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT23358 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT23358
Domain Number 1 Region: 454-758
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-71
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 318-426
Classification Level Classification E-value
Superfamily PapD-like 0.000000000445
Family MSP-like 0.0081
Further Details:      
 
Domain Number 3 Region: 14-161
Classification Level Classification E-value
Superfamily PapD-like 0.00000000133
Family MSP-like 0.0055
Further Details:      
 
Domain Number 4 Region: 175-309
Classification Level Classification E-value
Superfamily PapD-like 0.000000994
Family MSP-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT23358
Sequence length 780
Comment pep:novel supercontig:GCA_000347335.1:Scaffold21126:63391:72332:-1 gene:F775_13946 transcript:EMT23358 description:"Cysteine-rich receptor-like protein kinase 26 "
Sequence
MDRLKKKVKQKTSSSARGGMIQVEPSELRFPFLPNAMLSASFSIKVVNVTDNYVVFVTRP
MGADVARYTTYPDGGILPPRSTQEFLVRRTTKKSVAQSIECDDKYIECGDKYILCSTIVS
ESFSNSKYASDLDKFYHDHGDQIWHRIKLGVVLYPTYQQDSPDGMPHTELSLPAPEELIQ
VQPSEIHFPFLPNVMLSASSLIKVLNITDNYVVLVSRTPVANVAEYGTRRNAGILPPRST
QEFLVRRIVKKSVVQSIKCDDKYLLFSTTVSKSFINSEHCVDLNKFFDKQSGQIWHIREL
AVVLEPAYREGSPDDLVELIQVIPHELRFPFVPDESISVTSLIKVVNMTDDYIAFHPRYN
VANMAEYTMTPTGGILRPWSTQDIVVTRKSRKGVLQSIKCNDTNFLYSTVVSEDFQSDDL
GKFYDTEVGVIWHKLELGVLLEEDTQLQPSEFLTHNETESTLDPMSLQHLKDITNNFSNE
RILGRGGFGVVYKGVLGNGKMVAVKKLVQSMPSSQQQFENEVNLLMKLKHPNIVRLVGYC
YETQHLRGHHEGKIVFAWNTECLLCLEFLLKGSLDKYISDASSGLDWPTRLKIIEGIFYG
LQYLHEQSDGPIIHLDLKPANVLLDKNMIPKLTDFGLSRLFDQKQTIHTAINSGTLGYMP
PEYLRGIITPMSDIFALGVTIMEVITGHREYPYDIRTSSTEFIEHELQKWRNVLQKQQGY
TSLEIDCQQITRCIQIGLICVNPERTKRPTMKKIIDMLQGSKSMDWYISNEVMSRASSVR
Download sequence
Identical sequences M8BNG4
EMT23358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]