SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT23566 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT23566
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000412
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 160-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000589
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT23566
Sequence length 272
Comment pep:novel supercontig:GCA_000347335.1:Scaffold20572:40944:42031:-1 gene:F775_27633 transcript:EMT23566 description:"B3 domain-containing protein "
Sequence
MAQGQGSPDLVGFQFYKLMAAGMSWEKLVLPDKFVRGLNGRELRGVKLRVEGGGARAWDV
EVVVNECGDMHLGRGWKEFVRANGVELGQLLVFCYDGAGAALLTVKVFDDSECGRHCSQR
EEENDSVEEEEPPPPALPGSGSSSSDGVVHGGGGGAAPSRFTVTLGQCHLGTKKKQYLNV
PVEFSQSHGFTEKGRVVLRMRGQQWTVCLKHSNRRKGNARTRTALRYGWNRFRVDNGLRV
GDICFFQLVQDAGGDDPVLSVEVRKADGTIVQ
Download sequence
Identical sequences M8CJN1
EMT23566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]