SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT23837 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT23837
Domain Number 1 Region: 18-89
Classification Level Classification E-value
Superfamily PapD-like 0.0000000000366
Family MSP-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT23837
Sequence length 223
Comment pep:novel supercontig:GCA_000347335.1:Scaffold19925:54400:57262:-1 gene:F775_26786 transcript:EMT23837 description:"Uncharacterized protein "
Sequence
MAASSDLLDVDPPELQFPLTMQAQTVAPPDLQCKDKFLVQSVVVADGLSAKDITPQMFMK
QEGNVVEEVRMRVTYVMPPESPSEIAEESDGPQRILAPMQRIVNNGRSASELSSGSVSLR
SAELGTEVGSPTGPVVRTEELLKAAGHAAETRTYTGPDAQSLELLALITKLTKEKDSALE
QNKKLHNELELVRRDASKQGGFSLIFVLVCGLLSIILGYLVKK
Download sequence
Identical sequences M8C9W4
EMT23837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]