SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT23901 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT23901
Domain Number 1 Region: 947-1089
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.03e-34
Family Single strand DNA-binding domain, SSB 0.0003
Further Details:      
 
Domain Number 2 Region: 1120-1233
Classification Level Classification E-value
Superfamily BRCA2 tower domain 4.9e-30
Family BRCA2 tower domain 0.0023
Further Details:      
 
Domain Number 3 Region: 840-946
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.09e-27
Family BRCA2 helical domain 0.00067
Further Details:      
 
Domain Number 4 Region: 1090-1119,1233-1318
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-21
Family Single strand DNA-binding domain, SSB 0.0096
Further Details:      
 
Domain Number 5 Region: 1321-1459
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.97e-16
Family Single strand DNA-binding domain, SSB 0.035
Further Details:      
 
Domain Number 6 Region: 1513-1548
Classification Level Classification E-value
Superfamily HAD-like 0.000000355
Family Meta-cation ATPase, catalytic domain P 0.013
Further Details:      
 
Weak hits

Sequence:  EMT23901
Domain Number - Region: 1468-1538
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000611
Family ABC transporter ATPase domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT23901
Sequence length 1654
Comment pep:novel supercontig:GCA_000347335.1:Scaffold19806:30082:50205:1 gene:F775_01330 transcript:EMT23901 description:"Breast cancer type 2 susceptibility protein-like protein "
Sequence
MADLLVQGSASCLHLFSIRPARNTLLEGDGMSGATVDAGQGQLFCTGSGRSVSVSERAIR
RARALVGEEVEKAGNKRKQPFDDVPGAEGELREMDAPFRGGVHNTAVPPVFQTGPGKAVL
LGKDSIQKARAILGEQPFDHVPDAERESSEMDAPFRGGVYNTTMPPVFQTGSGKAVLLGK
DSIQKARVLLEDVDSAAGAVQPMFRTGMGRPVPVSRTSIDKARAVLEGQTVAEKGVNGME
QFPLFQTGSGRVVSVSAASVQKAKSVLKDNNTSEGRPAMISERSIERSRAVANEGDAEKS
GHWDTDCQFPMFQTGLGKPVAVSWSSVQKAKAVLEEEKIKTTGRGESSDCATTLQTETPT
SVLMSSSLIMNSRSVTPKEDSAMQVTRTEKNHKDDDHVPLFQTGLGRSIAISKSSLKRAS
AVLEPRNIAKELEDEAHLDGAHDTPVFRTGLGRSIIASENSRKELPILEAEEAVKSVNNY
NGETFVEEATFQAGIQKFVPQNRISSHKASMLLEQRNFMEKDNHKLLNMDKKIPVFASPL
KTSCARTVNISSVGVSRAATLLGLEENTLSTQFFGHVGDKLGTKINFEQENPEQRLGLAS
YPTENQVHKEQHRPFELSNNTVSDSGEHSIRFSTAGGRSMAISSDALERAKSLLGESDLM
VSTNNLSYPLGSACNDKMQNSTVAPKEGGSDLSKRRRVSGRTELATFSHQAMSDRKDTGS
FGNAVSDIHPTSENTNRFHVGSRSTSEIPKIVKPSSRCLSETDNTNDTKDKTRQLHMPAG
ALVDISNFMGSYSGNIDHVVNEKRRIGGRNSASSFKRPRSSRFITPISTNRQSSAGVPKL
PPTQITSCRTKLSAYYPFQHKRKTWKEYFGGPPCFNCLAEHIIDEVKLMDAKGAERWVNN
HYKWIVWKLASLERCYPTKAAGKFLTVANVLDELKYRYDREVNNGHRSAIKKILEGNALP
SLMMVLCISAIYSHPDVHKLEAVGTDENENSIKNKSLLAAKRNMPAHIELTDGWYALEAS
LDVALSEQLQKRKLFIGQKLRIWGASLCGWTGPVSFHEASGTVKLMVHVNGSYRARWDDP
LGFCKHVGPPLAFKCIKASGGRVPRTLVGVARIYPVLYKERLPDGSSIVRSERMERKALQ
LYHQRVSKIAEDIMSEQDENCASTDDSEEGAKICKMLEQAAEPEVMMAGLTSEQMISFSS
YQAKQKEARQNEVAKKVENALEVAGLSSRDVTPFLKVRVTGLAHKISATKTINKEGLITI
WNPTEKQKADLVEGQVYIATGLLPSAHCTNILYLHARGSSTMWKPLASAQAADFQPFFTP
RKAVELSLIGEVPLASEFDIAGVVLHVGDVYLCSNQKRQWLFLTDGSKFISASQSTDQDD
CLLAVSFSCSSASDDGAFFSYALSGNTVGFSNLVKRQKDQTRRIWVAEATQSSTYTLSHE
ISKKSHLKEAATCAEKWASSSFDDDACHGPSGCGKTTLLLALVGKLNKDLKDHRRVRGRG
RYLGQLPRCIGDVDIGLAMGMSGTEVAKESSDIIILDDDFTSVVKVIGFVHGDVTEQKEQ
VDGYFHCFRFCFGSNCVYGILAFLGEAVMNILADLWIYHCMKYSPGVLSPTLISDVILVY
NKPLLPTPQFLMDYLDKASGEWHAFYASQASVNA
Download sequence
Identical sequences M8CKI5
EMT23901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]