SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT24046 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT24046
Domain Number 1 Region: 159-303
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.22e-45
Family Mannose-binding lectins 0.0000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT24046
Sequence length 304
Comment pep:novel supercontig:GCA_000347335.1:Scaffold19434:26026:27695:-1 gene:F775_25349 transcript:EMT24046 description:"Uncharacterized protein "
Sequence
MANFQITPRAAFVESNELNFRSLYLFHTPLGSNQNQSGIIDSNVTTGLGATVVNNWPICD
GPSPGATVVARAQGLHIYAGNWQNTFSITFGVERFKGSTLQVMGISVEEGEWAIVGGTGQ
FAMATGVIYKKFHEQRSDGNIIELTVHGFCPVLKGSQSLPTKVGPWGGNGGSDKDIVEAP
RHLESITVSSGTIIDSIKFSYVDQAGQKCTVGPWGGSGGKQNTFVLGTSEFVKEVSGTFG
LYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFFGRSGIYLDALGVY
VHPL
Download sequence
Identical sequences M8CKV5
EMT24046 XP_020162849.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]