SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT25906 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT25906
Domain Number 1 Region: 87-136
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-19
Family RING finger domain, C3HC4 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT25906
Sequence length 150
Comment pep:novel supercontig:GCA_000347335.1:Scaffold15129:84195:84647:1 gene:F775_33144 transcript:EMT25906 description:"Putative RING finger protein "
Sequence
MDYDDMLDWIIWVLLLIFAVIAALSAAVALAVAIAEVVRHVRQHCKWLSIERLLESIPDV
AYKQMPDRDGGSPSEEEGKELRRSQSSCVICLAQYEGGERCSVLPGCGHVFHRGCVATWL
HTTHNTCPLCRATIAAGAAARKDNAAEDMV
Download sequence
Identical sequences M8CQH9
EMT25906 XP_020162991.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]