SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26002 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26002
Domain Number 1 Region: 1115-1286
Classification Level Classification E-value
Superfamily DNase I-like 4.45e-19
Family DNase I-like 0.034
Further Details:      
 
Weak hits

Sequence:  EMT26002
Domain Number - Region: 303-396
Classification Level Classification E-value
Superfamily HCP-like 0.00162
Family HCP-like 0.049
Further Details:      
 
Domain Number - Region: 73-217
Classification Level Classification E-value
Superfamily TPR-like 0.0215
Family Transcription factor MalT domain III 0.08
Further Details:      
 
Domain Number - Region: 1020-1063
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0922
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT26002
Sequence length 1299
Comment pep:novel supercontig:GCA_000347335.1:Scaffold14960:9358:30019:-1 gene:F775_33227 transcript:EMT26002 description:"Uncharacterized protein "
Sequence
MSRLLLRRFLCSSSSTTPAAGAGFIRELANLLAAGRFHASVGLAKSLLLSSRPPATSVPD
LYHALVSTAAASQVDPHPPSFLSDAASALVVASARLGLPDGALRLLSLLADARATLPSLS
SCNLLLESLLSLGRHADVRRAFDLLNAAGARPDTFTWNKAIQACVVAGDVDEAVRMLRRM
DCEGHGAPPPNAFSYNVVIAGLWRAGRGSDAVKVFDEMGKRAVLPSHITYNTMIDGHIKI
GDLEAGFRLRDQMLHHGLKPNMITYNVLLSGLCRAGRIGETTAVLHEMMSRKMVPDCFTY
SILFDGYSRVGDSQAMLSLFEESVKKGVKIGAYTCSILLNGLCNDGKISKAEEVLQTFVN
AGQLPTRVIYNTLINGYCQIGELEGAFSTFQRMKSCLLSPDHITYNALINGLGKAGRITE
AHALVTEMEKNGVSPSVETFNTLIDAYGRDGQLEKCFVLLSDMREKGLKPNVVSYGSIVN
AFCKNGKIPEAVAILDDMFHKDVLPGAQVYNAIIDAYIDCDATEQAFTLAEKMKTSGVPP
SIVTCNLLIKGLCKQSRISEAEELIHSLRNHGLTPDVVSYNTLISACCYRSNTDSALELQ
KEMCKCGIKPSSRTYRILLSALGGARRIHEMENLYKEMLDKDVVPCSRIYDIMVEAYVKC
GDESKAVAISPTAKSLAAYPKSPFQLRTPEIVHAPNGEVKSPPDVTPISLNLKELEAEEK
PQKSLNEKQQESQDLLIKRLVHWRSFEVERIGVFDRIIQTIGSAIEAPRTSRASLIKGSR
SQANALAQQTLIAHWQSIVKILTNDLNVLKANYVPSFLTSKVFTQIFSFINVQLFNSMQV
IHPKPKKTLKEITNDLCPVLSIQQLYRTSTMYWDDKYGTHTVSSEVISSMRIMMTEDSNN
AVSSSFLLDDDSSIPFSVDDISKSMTEIKILKTDWDVAGGGAQVVAGAERAEDFIPTNRW
LRKMDLPSRIAFMSVPRSRGRSLRQGHEEGARGPMRFYAQIKDNEDLDMLVVLPKFVEVM
NTWLVIKRLPRVVRLSANRGWNYFCRRHKIVPSDLVVVRISGLGLKVQIYNHDSSVMCRP
PHLNGVSRTQTLFATKQLKFASAHTLSTNAGNQTARGRSGGLVLFWNNEIKLEIQGYSKY
HIDAIMSELGTVPWRLSCIYGEAKVADRYKTWDTLRSLAGTSSLPWLAMGDFNEVLRQSE
HDGVSLRSQSQMDSFRDALDVCCLHDLGHSGLPWTFEKKVAGGSFTRVRLDRAVVDAVWS
SLFPSAQLDHVASACSDHSPIVLNFSEELMKIKGARPFK
Download sequence
Identical sequences M8CFR4
EMT26002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]