SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26018 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26018
Domain Number 1 Region: 442-542
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-22
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 29-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-19
Family B3 DNA binding domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT26018
Sequence length 557
Comment pep:novel supercontig:GCA_000347335.1:Scaffold14930:29203:33913:-1 gene:F775_05965 transcript:EMT26018 description:"B3 domain-containing protein "
Sequence
MAAADKERAREKGKEKENGGEGGKFGQQFARVFLPQLYGERLKIPPSFNQYLQDQPTGVV
SLKGQSGNTWLAELASDNEGLFFVKGWKEFVRDHSIEMGHFLTFRYDGRSKFSVVIFDGM
CIEKPSAFHAKPCKNLVVKIESGKGDMDINAADPSQASAAPLEETDPPEAVVVPLEESNQ
TTRKRIREIDANDSALQKSLRVREIDANGSALQKSLRVREIDANDSALQKSSRVREIDAN
DSALQSSRVREIDANETALHKSSRVREIDANDSALHKSSRVREIDANDSALHKSSRVREI
DANDSALQKSSRVREIDANDSSLQKSSGLREIDANDSALQKSSIASDKDKKRCPAASVGT
YKSASTSLDSTEDSDSSSSMLEQSISCIKSELTSPIRLGVSKDVARRGQNSATGKRQLRV
LSQRRLVTEIQKDNALLRAKQFKSKNPFGLQIMKESYVYVGFFLNLPCEFVRECLPRAHR
KLKLWNPQGKSWDVNYVYYSERCVGGLSGGWGKFSLDNNLEKFDVCVFELFSKDNIKVHI
YRVVPEITPFLPGPGKK
Download sequence
Identical sequences M8BW15
EMT26018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]