SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26088 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26088
Domain Number 1 Region: 433-538
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000147
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 160-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000863
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT26088
Sequence length 542
Comment pep:novel supercontig:GCA_000347335.1:Scaffold14803:231369:234011:1 gene:F775_23325 transcript:EMT26088 description:"B3 domain-containing protein "
Sequence
MAQPARAGEPQSVHGNNQLQHRGEHELVHLVPLPPQPPEQRRGGLELPAQRVGLEERDEG
RRVPLGQGVEHPARAGQGPQLGVQVDQDVGAEEVEVQAAAPTKLKSSKTVNLVTLTTFSE
LWRCSTCRNLRSSCAECILSGCHLTKAQDEKVCEIACTVRSQVPLYVAAMNKSNVNLKGC
SVNLPLKLVEHFKEDTSKATIQLEAPNDNIYGVEACKHGDDQTVLQYGWNNLVDANRIQE
NDLLVFIIKGKKRLEVRILGTSVHQRTSSCFGTGNISSTQEIREDSLEITDPPPHTDYYV
SSSDDDHIMEEGYYVSSSDDDRIAEEDYVSSSDGDHIVEEGTRKSCRRQKQAPSCHAKAQ
KVASTSSPSAAKSGYEAHKLNERASVEFGVNLEPHSSTSNLEGPSQYPYILSEGRASLSS
AEKKKVEEKVQAIQSELPIYVVVMTKSRINADQLGIRMEYGARHIPHINRKTDLMLQAEG
STEQHTCRLVIDQSGKRWIRRGWKDFVTENKVREGDICLFERGESTKKLRMMVYFIRRSS
QT
Download sequence
Identical sequences M8BW76
EMT26088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]