SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26150 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26150
Domain Number 1 Region: 60-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.68e-19
Family B3 DNA binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT26150
Sequence length 171
Comment pep:novel supercontig:GCA_000347335.1:Scaffold14716:28431:29718:1 gene:F775_43588 transcript:EMT26150 description:"Uncharacterized protein "
Sequence
MASGKATKPGMEDDNDMEYSSAESGAEDSAAESSSPVLAPPRAAPSSRFKGVVPQPNGRN
GKGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVKETGLRAGDTVAFYRSAYGND
TEDQLFIDYKKMNKNDGAADAAVSDENETGHVAVKLFGVDIAGGMAGSSGG
Download sequence
Identical sequences M8BME0
EMT26150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]