SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26658 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26658
Domain Number 1 Region: 392-631
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.1e-49
Family WD40-repeat 0.00059
Further Details:      
 
Domain Number 2 Region: 25-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.08e-45
Family Protein kinases, catalytic subunit 0.0014
Further Details:      
 
Domain Number 3 Region: 259-324
Classification Level Classification E-value
Superfamily PapD-like 0.000000011
Family MSP-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT26658
Sequence length 646
Comment pep:novel supercontig:GCA_000347335.1:Scaffold13574:25502:29316:-1 gene:F775_03715 transcript:EMT26658 description:"Coatomer subunit beta'-3 "
Sequence
MAADSSSGKTDDGKIGAASAERNELPLQLLRNITGQFSEERRLGTGAFGTVYKLELLSEV
VRCIQFDMISKPREVPKKMDWETRFKIIKGVCKGLLFLHSIPIVHMDLKPENIWLDNYMR
PKIAEFGLSRIFGQEQTRMNAQNIVGSYGYIAPEYLYRGEISTMSDIYSLGLLIMETSTG
EKNCPGNEPSAVKFIKNVRDNWTEERIASEYPSLDPDCLKQIKACINIGLECVEIGRRKR
PSIEKIMDTLNRLSQVDSNNVLSLQPQRINFPIGPKRLTSSSLYLINNRDDRIAFRLETK
FPRRYLTKLPLCGVVPPKCTYILTGLILQSSIAHHEDLDSVDPASVAMFLDTAGDEVQEA
KVEVACEPLVETISNDQVSSVKIMIIDGPNYREVLSVDVHPTEPWILTSNKRGHVCIWNY
QTQAENFKPVAVITYENYSFDIILPVAVYSAKFIEREGWFVVGGDDGCIYVYNYNTMKEV
YMIEEAHDDRIMCLVVNPTHSFLLSASDDHKIKLWDWANEWQCTRTFEGHDDTVTQIWNI
HSETCNITWDEHPDGVLSVHYHPRYFQQSLICGSSDGDAKIWDLETDSCVDTLEGHEKGI
NALCWHPELRALVTGSLDGTVRILSWMCHSNTYKYLFLLMYSLTPR
Download sequence
Identical sequences M8BXY4
EMT26658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]