SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26797 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT26797
Domain Number - Region: 7-51
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000785
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT26797
Sequence length 102
Comment pep:novel supercontig:GCA_000347335.1:Scaffold13287:107158:107631:-1 gene:F775_03501 transcript:EMT26797 description:"Uncharacterized protein "
Sequence
MTTAQKFNCLVTNDANRTYFGCPGWKALADAYEMEAGERATFYLDYDRDEIMVYYKPAGS
DDGALTPDYDPDSARLDLVIVLKLDYALILAEIAAAKLLFQI
Download sequence
Identical sequences M8CHT6
EMT26797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]