SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26934 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26934
Domain Number 1 Region: 6-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-63
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 291-419
Classification Level Classification E-value
Superfamily PapD-like 1.7e-18
Family MSP-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT26934
Sequence length 421
Comment pep:novel supercontig:GCA_000347335.1:Scaffold12996:54027:55990:1 gene:F775_14007 transcript:EMT26934 description:"Cysteine-rich receptor-like protein kinase 6 "
Sequence
MDLQLHLIETITNDFSEDQKVGSGGYGEVYKAVYNGKEIAVKKLHPLQGLDDKQFHSELL
NLAEVSHKNIIRLVGYCHESKNKYIKHNGETIWAKSMERILCFEYMQGGSLEKHIADESC
KLDWPTCYNIIRGTCEGLNHLHSAPDKPIFHLDLKPDNILLDKSMTPKIADLGLSRVFAS
SETHQTEIVKGTHGYMPPEYLQHRLISKKFDVFSFGAIIIKMVAGNTGSSRRSQMPPMEF
IKLASEYWTKRLQAMPASYSSHQVDILRVTKCVDIALSPLIQHFWLRSRDTNVVSVDPTL
EMRFLFEPRKDVSCCLQLTNKTDDFIAFNVKINQTKYHARPSRGTMPPCSKRYIAITLRA
QAAAPLNMRCHDMLLVQSTRIDQELASDHEEIDYQELFKAAMTDKVVDVVKLPIVYVTAG
Q
Download sequence
Identical sequences M8BY75
EMT26934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]