SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26935 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26935
Domain Number 1 Region: 4-296
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-65
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 325-453
Classification Level Classification E-value
Superfamily PapD-like 1.6e-17
Family MSP-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT26935
Sequence length 454
Comment pep:novel supercontig:GCA_000347335.1:Scaffold12996:84003:86052:1 gene:F775_14008 transcript:EMT26935 description:"Putative cysteine-rich receptor-like protein kinase 23 "
Sequence
MDFKLHDIEAITNNFAEAQKVGSGGYGEVYRAIHEGEEIAVKKLHQLQGLDNKQFDSEFR
NLRNIRHQNVVRLIGYCYETKSKYMKHNGELVFATIMERVLCFEYMHGGSLDKHIQDESC
GLEWPTCYKIIKGTCEGLDHLHTSQGKPIFHLDLKPGNILLDESMTPKIGDLGLSRLVAS
TKTRQTEMRDGTLGFMPPEYIDSGFISKKFDVFSLGVIIIKMLAGDKSYFRCSEMPSEQF
IELVTEIWTKKLQAKPGYSSHEIDMLGVTSCVEIALRCVDRDRNKRPCINDIVHELDQLE
AKLKEMSLASDVSNDATVQRSCDTNIISVDPSLELRFVFEPRKETSCCLQIINKTEGIVA
FNIKINQNKYSVQPSQGTMPPCSCRYVIVKLQSQDAAPPNMRLHDMLFVQNTGITQDLES
RDGEIDYQELFEKAMADKVVDVVKLPIVYVTPDQ
Download sequence
Identical sequences M8BPJ2
XP_020188054.1.58150 EMT26935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]