SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26998 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26998
Domain Number 1 Region: 217-319
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 477-582
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000153
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 3 Region: 62-146
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000182
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT26998
Sequence length 587
Comment pep:novel supercontig:GCA_000347335.1:Scaffold12870:48352:51053:1 gene:F775_23087 transcript:EMT26998 description:"B3 domain-containing protein "
Sequence
MWRQHYHRGHTGHDKEHFFAVASGDFTHPQYGQLTWPFLPSIHFFSCACSLLQSFIISAI
SNLIDINLCIPWEVGDHLGSMISETITLEAPNGIFCIGVCRKAGELVLQSAWDKFVAMHH
IEENYSFWFVCPGNSTFKVHIFNPNGHEKASSCSQPPSQSFGGVPPGAICDHHAPNEQLL
SDPGHVRTSTDYGYSTLPGCHLTKAQDEKVREIACTMRSQVPLYVAVMNKSNVNLKDCSV
NLPLKLVEHFKEDTSKATIQLEAPNDNIYGVEACKHGDDQIVLQYGWKNLVDANRIQEND
LLIFITKGKKRLEVRILGTSVHQRTSSCFDLGNISSTQEICEDSLEITDPPPHTDYYVSS
SDDDHIVEEGTRKSCYYVSSSDDDHIVEEGYYVSSSDDDHIVEQGTRKSFYYVSCSDAHD
IVEEGTRKSCRRQKQAPSHCAKAQKVASTSSPSAAKSGRTPLTSVEKKKVEEKVQAIQSE
LPIYVSLMTKSRINASHLGFRREYGSRYIPHINRRMRLVLQSEGSTTGQPATVVIDKNGM
RWIRGGWKRFVAENDVQEGDIALFERAKSTKELRMTVYFVRKSDIEV
Download sequence
Identical sequences M8BYY5
EMT26998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]