SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT27061 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT27061
Domain Number 1 Region: 99-202
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-27
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 492-557
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000262
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT27061
Sequence length 637
Comment pep:novel supercontig:GCA_000347335.1:Scaffold12736:36014:41957:1 gene:F775_27540 transcript:EMT27061 description:"Auxin response factor 9 "
Sequence
MAMANPSAAGAPGICSDALFRELWHACAGPLITVPRQGERVYYFPQGHMEQLEASTNQQL
DQYLPMFNLPSKILCSVVNVELRTEADSDEVYAQIMLQPEANDMSQNPPCQELVAKDLHG
TDWHFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRHMRQVNN
MPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPRTSQSEFVVSVNKYLEAKKQNISVG
MRFKMKFEGDEALERRFSGTIIGIGSTPTVSTSLWADSDWKSLKVQWDEPSSILRPDRVS
PWELEPLDAANPQPPQPPLRNKRPRLPASPSVSIILEFYISKLVLFVSGLWKSPAEPSQT
LSFSEPQQARGLFTNSRFSSSSNVAFNQFYWPARESREDSYAGSTNKVTVERKLEPAAGG
CRLFGIEIRSAVDETQPVLTVSGDGYDQTAASVDVDSGELSQPSNINNSGAQAASSERAL
LETQSRQVRSCTKVIMTGMAVGRAVDLTKLYGYVDLHCKLEEMFDIQGELCSTLKKWQVV
YADEEDDMMLVGDDPWDKEAFWHFVTFSRQLFYARTGEIGHLCLSFPEVQCELLSTDSAA
AKQNLNHRANPAESGSRNPLPKSEPKAEAAQDVLSKI
Download sequence
Identical sequences M8CTG9
EMT27061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]