SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT27224 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT27224
Domain Number 1 Region: 362-661
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-64
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 34-263
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-60
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 3 Region: 869-1032
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.24e-35
Family WD40-repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 704-826
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000034
Family MSP-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT27224
Sequence length 1058
Comment pep:novel supercontig:GCA_000347335.1:Scaffold12431:59799:71751:-1 gene:F775_03260 transcript:EMT27224 description:"Cysteine-rich receptor-like protein kinase 5 "
Sequence
MASSLHSDSLMTADFCTRIIMEDTVIYSIDKSDVISDKPREVTFRQLMEITNNFEQKLGS
GTFGVVYKGVLNDGPVNRVIAVKKLHSTTEQIDDKQFKNEFELLRILKHQNIVQLVGFCN
ETEKVAAKYEGQMVVAEEIHRALCLEFVPNGSLGKFLSEQRPVLNWNLCFKIIKGICEGL
KYLHDVPINHLDLKPDNILLDDKMAPKITDFGISRLMGAENTVKTQTFLGTLGYIPPEFI
KKQIISREFDIFSLGVIIRKILTVVMMEGPSIVFTDGQECIEHVHSYWRKKLQGMPGYAS
SEVDCKQPWSNLKKFDLGLNCNFNEQMDYLLSGKFHGGLPKRDISKGPSPEIGTDVQGGT
LTVLSTLPKELPLDFLKSITENFSNERLIGQSAFGNLYKGICPDGTMIVVKKLVENPPVP
RDEAFSKEVQNIMAIQHKNIVKLIGFYHEGQKKIVEKGGRYIVADVFESLLCYEYLPMGS
LHDNLFESNSMDWNTRFKIIKGICRGLLFLHNIHIIHMDLKPENILLGDDMEPKIAEFGI
SRLLDQELTRLNTQDVVGTYGYMAPEYLHKGEFSAQSDMYALGVLILETTTGKKNGRKDP
SGREYIYEVQLNWTIDYIASKHRTLDVDSLWQIRACILIGLKCVHADRKMRPSIQGIVDM
LDGRACSSKPLIVPELLAWSSRRLIMPEPLAWSSRRLIVPEPLAWSSRRLIVQPPELRFS
FEPKRLISCSFSLTNTTDGHIAFMLVTENPRIYLTKLPLCGVVPPNHIYTINVTMREHKE
SRNGEFLTLRSSTAREEQLTNAHPDSLAGDEVKEVKLCVVCDPQEVDPISSRGHSQSELS
AGAVRRRAPKQTMDLDEQSEGLCLHLELPDQVYSAIFIEREEWLVAGGGDGYIYVYSYDT
MEEIMSFEAHDGRRIRSLAASPTHTFLLSASDDQMIKIWDWKNGWKCMRTFLGHGKCVTQ
MWDIYSPTCNATLDGQPDGVLCLHYFTYMNQQLLLSGSLDGAAKIWDPEKECCVSTLGGN
AKSVNALCWHPELHVVIRHVSIFSYYKTSARTKPIHVG
Download sequence
Identical sequences M8BZ34
EMT27224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]