SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28355 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28355
Domain Number 1 Region: 95-192
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-20
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 307-393
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000569
Family B3 DNA binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT28355
Sequence length 403
Comment pep:novel supercontig:GCA_000347335.1:Scaffold10276:29085:32453:1 gene:F775_02323 transcript:EMT28355 description:"B3 domain-containing protein "
Sequence
MAAAALAVGRSGERETREGQGEMKEKGKSAASCMYAHTLLSLHRIHGFGALATDKASCVS
AMVVAGEMMVDEKGRCGRCGEWQEHYYWEHMEDVSKIRFFKLMTGDFQQRISIPEKIANN
FIGKIANGGFTLKAPSGEEWRVGVEKIADELFFMPGWEEFAKAHELQENDLLFFKCSGNG
SFDVLIFDPSGCEKVSCFFANKKGIKMRKQFDNIVSQHGEEHCILSDSDDTSMPLSQLVR
STHKAPTSKKPTRPRNLHFCTIDVGKSSNYYLKNEVEQEEESDDDHTESNNYYYSRIANC
LTEDEREEIFRQIISSKFAADHLEGRSYEMLLLRPNRKEKWCLKYYHSRVTRGFNSRRWN
KFVRDNMLREGYVCIFELMKGARKATMTVHVLRKVDDKFVLLG
Download sequence
Identical sequences M8BTK8
EMT28355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]