SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28357 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28357
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.63e-18
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 190-247
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000235
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT28357
Sequence length 287
Comment pep:novel supercontig:GCA_000347335.1:Scaffold10276:34695:36704:1 gene:F775_02324 transcript:EMT28357 description:"B3 domain-containing protein "
Sequence
MEDVSKISFFKLMTGDFQQRISTPEKIANNFIWKIANGGFTLKAPSGEEWRVGVEKIADE
LFFMPGWVEFAKAHELQENDLLLFTCSGNGSFDVLIFDASGCEKVSCFFANKKGTNMHKQ
FKNIVGQQGEEHWKETESQKNNNYFLKNEAVEEEEESDDHHTESDYYYYSRFANCLSEDE
REEIFGLASIQLGNPVYVAVLQKTHVRRTKNFLIVPSKFAADHLEGRSHEMLLLRPNRKE
KWYLKLYDASAPVCNLKANFLVRYRSSGTKYEHCECSLTPVLAPAGR
Download sequence
Identical sequences M8CLT4
EMT28357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]