SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28373 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28373
Domain Number 1 Region: 157-299
Classification Level Classification E-value
Superfamily Mannose-binding lectins 3.01e-34
Family Mannose-binding lectins 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT28373
Sequence length 402
Comment pep:novel supercontig:GCA_000347335.1:Scaffold10222:51133:53396:1 gene:F775_25915 transcript:EMT28373 description:"Uncharacterized protein "
Sequence
MAKFQITPFPGLVENTEFNFGSLYLYNISNPPSYASIKENNATTGWGGASLVNWQIYDGD
GSGANLVGHAQGMQIHAGASHQSFTLVFENGRFKGSTLYVVGQTVRVEQAGEWSIVGGTG
DLAMARGVVKVKFHEKVKDGNTWELRFHGFCSMQSLPTLTKTGPWGGHGGSVTESEQPWR
IESMTIVHEGIIAMFSCSYVDLSGKRRTTGSWGGGNGIRTKVELGPREILKAVSGTYVSL
YNGQTVIESLKFVTNEGTYGPYGRTTGTPFNADVPKDQSIVGFFGRADDTQLIAFGVYTL
MPDRFSPKRRENKSEKTLQRGFLAWRIEEQQRHHTNNTFVKRRFSWAWQEVHLPLERLVL
VPLVRHRDVVHKPVVEEEGGRQGLGVRDACGQRIEVTDGEGD
Download sequence
Identical sequences M8C2W5
EMT28373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]