SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28380 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28380
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-24
Family B3 DNA binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 228-332
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-21
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT28380
Sequence length 336
Comment pep:novel supercontig:GCA_000347335.1:Scaffold10217:21539:23802:-1 gene:F775_23237 transcript:EMT28380 description:"Putative B3 domain-containing protein "
Sequence
MSKPWKKRKELDEHRYWNHTEEQDKHFFKVMIGDFHERMIIPDRFAQHFRGQTGRTIKLA
SRHGYTCDVQITKNLEKLVLDSGWKAFVRAHNLRTGDFLLFKYDGHSQLKVLIFGPSGCE
KIQACNLKKNVAPGKEWWGNTAGIVNTCHNLPMEFPHSGRQIRPSNDSSRQGNDIIDISS
SSSPSDSAGGISSSEDDHSLSGCILAKGTLLNLNHLQKKQLEEKIRAINSEIPIYGCVIR
KSSIYGKTRTLEISRKYAEVYLPFVEQMVTLQHHGKKWDVRCCVKNKKSKRLMRGWMHFV
RGNNLQLGDVCLFELLRNKKKYVMNVHIIRKSLYKR
Download sequence
Identical sequences M8BTM8
EMT28380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]