SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28535 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28535
Domain Number 1 Region: 64-144
Classification Level Classification E-value
Superfamily PapD-like 0.0000445
Family MSP-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT28535
Sequence length 197
Comment pep:novel supercontig:GCA_000347335.1:Scaffold9930:189785:191612:1 gene:F775_23688 transcript:EMT28535 description:"Uncharacterized protein "
Sequence
MDFDTIGRVVIVKEDVVEIMDINNQNKYPEESGHHSDSSLYYTTRPGGNNIDKVRNLPDG
HNPLEMWFTREPNKSIPYSLHLTNNIDQNVAFRLIEKSGRSMGHFKYEQPYGIVPPRSSY
TLVIKKEQASLGLAIQSSTSGDRYKMLFKDQSECDDFFSEVKEMGNLVHHVALKTVYSPH
QAGLTMSEVSWFIYTKH
Download sequence
Identical sequences M8BU18
EMT28535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]