SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28635 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28635
Domain Number 1 Region: 8-86
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000294
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 146-246
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000137
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 3 Region: 391-498
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000902
Family B3 DNA binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT28635
Sequence length 509
Comment pep:novel supercontig:GCA_000347335.1:Scaffold9768:10656:14189:-1 gene:F775_07403 transcript:EMT28635 description:"B3 domain-containing protein "
Sequence
MLLGTTTCIPWEVSSQLRDMIPDSEPIKLETPDGRTYSVKFFKFGRITLTTGWRGFVDAN
HIEENNPMLFVYRGNSTFKVQIFNSSGRDKFLPCSQPPCNHHVLNEQVVPHPGHVDSSAH
FGYTMLPGSFVTKAQDDKLLEWANTIKSEFPLFVAAMDESNVSLSDCHVYIPLSLVGQFK
EEVVKIVALDKSIYVVGAKKHNEDQIVLQSGWHRFVASQCIQQNDFLIFIIEGEARLKVL
VLDPSGSEKTFAMGNSSNAQEKPPLPPTVTNQSSEDNELTDQSSDNELTDLSSDNELTDL
SSDYEVLGKDTTTSRREQRPLRSCRAKAEKMGSTSCPSTKSDHRHKAGNSNEAGIEAPMP
NKSYIVPQAGATKLTVQQEEKVKEKVRAIGSEFPVFVKVMTAYDVSKMAHLAFCMEYASA
CRLPLEQTPLLLRLEGSNMRWSSALMIQQNNNVRRICSFWQDIVSQAGTKEGDILLVELA
GRSSRRLRMTVHLIRKSECSSSSCSQASS
Download sequence
Identical sequences M8BUD4
EMT28635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]