SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28753 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28753
Domain Number 1 Region: 92-161
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000687
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT28753
Sequence length 245
Comment pep:novel supercontig:GCA_000347335.1:Scaffold9570:21553:25559:-1 gene:F775_31360 transcript:EMT28753 description:"Uncharacterized protein "
Sequence
MATTASSTRRRRGPSDGGGEVLATAAQVDWNSVLQVSAAVNEKEGRSLVLHEQGIVNVII
HYSKVLASWLEIPISHGSCLLVDDYFCCEPYVPFIPCHSMVEFNCATGDRMLFEECEGCK
FITEIRKEHRRTCICGVGWEDFIRLNNLSEGVLLRFVLDRPVPKLQICMVAPPPNQADLA
LEAAVFTEDLKKKARESAKLNETLLYSILSFLVSIWTETTAKTRVKNCVDKKNDLNQMEK
QMTEN
Download sequence
Identical sequences M8C3Y4
EMT28753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]