SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28779 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28779
Domain Number 1 Region: 28-124
Classification Level Classification E-value
Superfamily PapD-like 3.4e-26
Family MSP-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT28779
Sequence length 212
Comment pep:novel supercontig:GCA_000347335.1:Scaffold9502:43232:45694:1 gene:F775_30350 transcript:EMT28779 description:"Vesicle-associated membrane protein-associated protein "
Sequence
MAGNPNKVEASISALKTEVWKMAATTHVKTTSPKKYCVRPNNGIVAPRSTFDVLVTMQAQ
REAPPDMQCRDKFLVQSAVVSQDISPKDINGDMFTKESGNVVDEVKLQVVYAPPSKPTSV
NEGSDQESLGSWSYQETTRELAEPETIPSDPLALILKLMKEEKNFAVQENNKLREELRLL
RREISRQNVGFSLLFVLVAAILGILLGFFMKR
Download sequence
Identical sequences M8C3H4
EMT28779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]