SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28807 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28807
Domain Number 1 Region: 43-286
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-55
Family Protein kinases, catalytic subunit 0.00073
Further Details:      
 
Domain Number 2 Region: 310-435
Classification Level Classification E-value
Superfamily PapD-like 2.59e-22
Family MSP-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT28807
Sequence length 453
Comment pep:novel supercontig:GCA_000347335.1:Scaffold9430:24103:31769:1 gene:F775_05581 transcript:EMT28807 description:"Cysteine-rich receptor-like protein kinase 26 "
Sequence
MAVVTERSSGVFISQDSVVEFGDKSSMNHEVLERILDGRENPTNLSLPLLKDITENFSED
REIGHGGFATVYKAYPQLKAATQDQIAIQIEGLKERIYAEVRERLLCFEYISNGSLTKYI
TDELRGLEWKTRYEIIRGICEGLYHLHKEKQIYHMDMKPDNILLDNDMVPKITDFGLSRL
DEMTQTMSKDRLGSLGYCAPEYWSQGKMSFKSDMYSLGVIIIELVTGQKALPINNNKILR
RWRHRWRKTGKETQLVYQQVAKCIRIGLLCQEIDPSERPFIWDIIDDIRQAEGVNGSIKN
DSQYKFGQISPYLEDDDMLGIEPLELHFPFQLNKQMSCTIQLTNETGSYIAFNVEHMNPL
SYCAQPQKDIIPPRSKCNVEITMQPQAKAPRDHTSEFTVWSTKVNDGLAIEDMATIKFIK
EAINVVDDVNLDVAFDISEPQEASEKTSVLIPG
Download sequence
Identical sequences M8CMY6
EMT28807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]