SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT29005 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT29005
Domain Number 1 Region: 15-159
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.38e-25
Family Protein kinases, catalytic subunit 0.0027
Further Details:      
 
Domain Number 2 Region: 185-310
Classification Level Classification E-value
Superfamily PapD-like 8.11e-21
Family MSP-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT29005
Sequence length 316
Comment pep:novel supercontig:GCA_000347335.1:Scaffold9003:30953:34477:1 gene:F775_33143 transcript:EMT29005 description:"Putative cysteine-rich receptor-like protein kinase 33 "
Sequence
MKIEGSREYIYAEIRERLLCFEHIGNGNLHEYITDNHMVAKIADFGSSRLDEKSQTMDAN
RCVTLGYCCPEYLLGGKMSVRSDIYSLGVIIIELVTGCKEIPANSNVLRRWRHRWKKSLK
ETPWAYQQLQITKCIGIGLHCQESDPYKRPFIWDVIHDINKTDGTLEQTSNADESDAEQI
RPHWDDDMLGIEPLKLHFHFEPNKQISCLLQLANDTTASIAFSIQPVSPMPYCIQPNKGI
VPPLSSCAVDITLQLQSKPPKDMQHLGEFVVRSTKVADGITTKEITSDMFSKVSSEVVDE
VNVDVVFDMPLLLEET
Download sequence
Identical sequences M8BVD5
EMT29005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]