SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT29006 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT29006
Domain Number 1 Region: 73-189
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.85e-33
Family Protein kinases, catalytic subunit 0.0017
Further Details:      
 
Domain Number 2 Region: 230-352
Classification Level Classification E-value
Superfamily PapD-like 5.49e-20
Family MSP-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT29006
Sequence length 361
Comment pep:novel supercontig:GCA_000347335.1:Scaffold9003:35740:40379:1 gene:F775_00322 transcript:EMT29006 description:"Cysteine-rich receptor-like protein kinase 25 "
Sequence
MASLAGAVQLLVIRSSTLKLNNLEALLVIELQQRRASYEVDDNISKASDSRSMGHDVLEH
ILDGTEEPTNLPFELLKNITGNFSEEREIGHGGFGMVYKEKTILHMDLKPDNILLDNNMV
AKISDFGLSRLDEKSQTMDAKRCVTLGYCSPEYLLGGKMSVKSDMYSLGVMIIELVTGYK
DIPDNNNESDPYRRPFIQDIIHDMNGNEGTFGQNSNADGFYADQTRPCWDDDMLDIEPLK
LHFQFELNKEISCLLNLDNSTTAAIAFAIQSVSPMPYCIQPNKGIVLPLSRCAIVITLES
QSMPPKDMQHLGEFVVQSAKIIDGVTPEEITSDMFNKVSGEVVDEVNVDAIFDLALLLEE
S
Download sequence
Identical sequences M8CYQ2
EMT29006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]