SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT29438 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT29438
Domain Number 1 Region: 22-154
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000000314
Family MSP-like 0.0077
Further Details:      
 
Weak hits

Sequence:  EMT29438
Domain Number - Region: 134-196
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0029
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT29438
Sequence length 199
Comment pep:novel supercontig:GCA_000347335.1:Scaffold8197:84603:85630:1 gene:F775_12871 transcript:EMT29438 description:"Uncharacterized protein "
Sequence
MNSSTLIQKCSKNYVTTLYRMTSTSAPSNELIQVDPPELRFLVVQEVSSPLKITNITDHH
VAFTIWSSTNRADYNALPTKGVLSPNATVQVVVTRVAHDWVPADLAPEEVVYVKGIVVVE
GLDAKDVTYDMFKPKTGRIVHEVELDVVSVASEIIPNIRLPWTLDVHPTEPWIMTTQGDY
HVHIWNYETRERIMCSQEF
Download sequence
Identical sequences M8C5W0
EMT29438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]