SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT29834 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT29834
Domain Number 1 Region: 12-252
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-48
Family Protein kinases, catalytic subunit 0.00087
Further Details:      
 
Domain Number 2 Region: 329-441
Classification Level Classification E-value
Superfamily PapD-like 0.00000000942
Family MSP-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT29834
Sequence length 488
Comment pep:novel supercontig:GCA_000347335.1:Scaffold7412:61161:65572:1 gene:F775_00104 transcript:EMT29834 description:"Cysteine-rich receptor-like protein kinase 38 "
Sequence
MENTAQRSGNEPSKLPYEFIKLITKDFSEELGHGTFGIVYKVAHVHVDNYASSYVMRRTH
MRYAYEMDRLKARVKYWLTYPKWGLKHPNIVELVAFCNEIVEEPAEFQGQQITAGRVRTA
LCFEYVHNGGLNKFISDQYTGLGWSERYKIIRGVCEGLAYLRLEIENPIMHLDLKPENIL
LNKNMVAKIADFGISKLFGEENTKKTMSVIGTMGYWPPEYIKHQIISKEFDIFSLGVIIV
KIMVGQENYNYIVETPARKSIKFFYEDDGDSSTLPSDINDITINSTPCSALELVEHNTLA
IMDTVHTLNETETSFFPQSENGSDLKLLDSEDTELLHVQPRELCFPFMSSLEVLPRKKAM
ISCSLQLNNKENDRVAFMLVAKTPKRYLTRKPLCGIVPPRCVYTLSLTMPKQPPVTSSSD
SGGDYFTLYTTLMSQYDLRDHDKDSISVKYHKLFEKAKLAGEEVHELKLRAICDQPAQGA
SSSDQVTN
Download sequence
Identical sequences M8C6G8
EMT29834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]