SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT29836 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT29836
Domain Number 1 Region: 293-600
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-67
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 620-725
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000262
Family MSP-like 0.01
Further Details:      
 
Domain Number 3 Region: 43-200
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000981
Family Adenain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT29836
Sequence length 792
Comment pep:novel supercontig:GCA_000347335.1:Scaffold7412:83673:90266:1 gene:F775_00105 transcript:EMT29836 description:"Cysteine-rich receptor-like protein kinase 29 "
Sequence
MAELAWKYVLGNLLVRPEQVPLLSTQMGRLHKWYMKEVKIGREMLMLCNQDTLDKFIVSC
YCLIKILECRRDGVYGIGFIDPYTINEVMIQNHAKDSEDNLLRFLKELNTRTYNFKVWKR
FIKVVVGEWKPQLKWRRSKCMRQQQGTNLCAYCVCENIRFTTKWRKDVRQHRMQEMRDML
LLENRIRAIQEEIAGFLLTEMLLAIKTLMIGIDEAAEDDIVRCNTSRWRRESVTSPTCSS
IKPPEYTCIYTPLGKRYVAAWKLYHQETGKAQLTRKKKILNLKLEGNSEPVMSTHMDNIL
DVEPRAMSFHFVRDTTNDFSEEQVIGQGGYGIVYKGVDRDGPVIAVRKLYPIREIDDEQL
QKEFTGLKMLNHPNIVRLLAYCYEQEQLLIPYKEKHIFAPRTIRVLCFEYMKNGSLDQYI
EDASSGLSWHGRYQIIKGISEGLRYLHEGLKTPIIHMNLKPSNILLDHNMIPKIADFGLR
RLVGEGNARCMGTIAYMSPEFIERQIISHKCDIYSLGVIIIKLITGERLYSGHFDMSSDR
FIELVSGSTSTFPLVALIVSMLYMGYSIYKQIKKCLEIAFKCVELDRHERPSIGDIIDRL
NETETLIPEEVRAVHTRIDSTHSELLEVHPQELYFPFMLKGRCEAMSSCSLQLKNRGDNR
VAFMLVASNPDRYLTRKPLCGIVPPRCVYTLSLTMLQQTASTSSSDSSDFFTLYTTAVGQ
HDLLDVPKDVVSVEYDYFFKKVQKMPGARDKVQVATLKVICDRRPATKSIGRSSSPEEFK
KAHKEFKKFTGF
Download sequence
Identical sequences M8D0Y7
EMT29836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]