SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT30363 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT30363
Domain Number - Region: 199-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00471
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT30363
Sequence length 267
Comment pep:novel supercontig:GCA_000347335.1:Scaffold6403:212819:217873:1 gene:F775_24856 transcript:EMT30363 description:"Uncharacterized protein "
Sequence
MTQFVYVVDSSFPEAWTGFSRKAFASLDGFIRLCLTSAVMLCLCIYFSLELAEWSTPRKM
GKTEPVRVQFIPVLDSVSVPTKPNMSVRNSARNRITTDQWHCRFSGHCRVSLDTGECTGL
FEIEATNGICQGCPLTTCPRSGFTEEKSIMKFAVVMIAGLPNRFLSLTTEPTNQLLSTSV
MMLYSLVSFTKKYLCRCIDPKLYDLLIKSRDGNPCIKARLIKGVNNRAKITRGWAGFFPA
ANMKEREIYAFAFKRNYKRLGLTVHAL
Download sequence
Identical sequences M8C8G4
EMT30363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]