SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT30488 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT30488
Domain Number - Region: 18-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00165
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT30488
Sequence length 142
Comment pep:novel supercontig:GCA_000347335.1:Scaffold6054:77111:77644:-1 gene:F775_03886 transcript:EMT30488 description:"Uncharacterized protein "
Sequence
MDATYETYGSVRCQRDKKFFIDLLNYFLTRTVIPCGARRDFLEKFKVPVDAIITFQCTLM
KMLTAQKFNCLVTNDANRTYFGCPRWKALANAYEVEVGKRATFYLDYDRDEIVVYYKPAG
SDDGSLTPDYDPDSACRKVVVS
Download sequence
Identical sequences M8C8S4
EMT30488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]