SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT30545 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT30545
Domain Number 1 Region: 157-209
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.75e-18
Family Skp1 dimerisation domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 10-70
Classification Level Classification E-value
Superfamily POZ domain 3.41e-17
Family BTB/POZ domain 0.0013
Further Details:      
 
Weak hits

Sequence:  EMT30545
Domain Number - Region: 97-123
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000144
Family Skp1 dimerisation domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT30545
Sequence length 209
Comment pep:novel supercontig:GCA_000347335.1:Scaffold5927:85081:87462:-1 gene:F775_14039 transcript:EMT30545 description:"SKP1-like protein 1B "
Sequence
MAAAEGKKKIIKLKSSDGKEFEVEQVVAMESQMIRHMIEDDYTDNGLLLRNVNSKILSKV
IEYYNKHVQAKATNTSDFGGGARASDATSAVPAALAEDLKNWDANFIKVDKDTIFDLMLL
CWFIIDRVVVYVINHVFVNPCFPLTHHYSFCTFAPSQAANHLNIKGLLDLTCQTVADMMT
GKTPEEIRKIFNINEKLKPEEEEEIRREN
Download sequence
Identical sequences M8BZV1
EMT30545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]