SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT30608 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT30608
Domain Number 1 Region: 64-163
Classification Level Classification E-value
Superfamily PapD-like 7.59e-28
Family MSP-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT30608
Sequence length 302
Comment pep:novel supercontig:GCA_000347335.1:Scaffold5829:53288:57492:1 gene:F775_29270 transcript:EMT30608 description:"Vesicle-associated membrane protein-associated protein "
Sequence
MQLSNLSDDYIAFKPSDCMVQSRSRYEACMRTFAHNRFRRFIILDYFVYLCYFIVFLAIR
WLEVKTTSPKKYSVRPNTGVVLPRSTCDVVVTMQAQREVPSDMQCKDKFLVQSVVAPSGI
NVKDVTGEMFMKESGNKIEEVKLRVTYVAPPQPPSPVPEESEEGSPSRVESENGDGPAGG
FTRALRERIEPQEKSLEFPENGRGLTHYVTFDYWYLVSRCNPPPNFPLHAAMPHQQVMHV
AGALISKLTEEKNSAIQQNHKIRQELDMMRREVSKRRGGGFSFVIVIIVALIGIFLGYMM
KS
Download sequence
Identical sequences M8C928
EMT30608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]