SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT30659 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT30659
Domain Number 1 Region: 74-174
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000114
Family B3 DNA binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 317-427
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000131
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT30659
Sequence length 431
Comment pep:novel supercontig:GCA_000347335.1:Scaffold5740:188906:190649:1 gene:F775_23488 transcript:EMT30659 description:"B3 domain-containing protein "
Sequence
MGIQPLMFTYSIHPAVTSFCPVLNHLVIIMCRMNKRCLILDMLIAQPTLAIPCCPGAFVT
KEQDGKLLEWAHTIKSGFPLFVAAMDESNVRLNDCHVYIPLSLVRQFKEEVVKIVALDKS
IYVVGAKKHNEDQIVLQSGWDRFVTSQRIQQNDLLIFIIEGGTRLKVLVLDPSGSEKTFA
MGNSSNAQENPPLPPTVTNLSSEDNEVADLSSDDEVIDLSSDDEVIDLSCDDDEVVGKDT
TTSRREQRPLQSCHAKAEKMASTSCSSTKSGHGHKAGKSNEAGLEAPVSNKPYILPQSGR
SLTKPQEEKVKEKVQAIGSKFPVFVKVMTPHDVGRPGPTKLCFCVEYASACHLPLKETPL
LLRLEGSDIQFPATLSVLRYNGGRRIYGGWRGLVSQAGMEAGDICLVELVDRSSERLTMT
VYLICKSEMQL
Download sequence
Identical sequences M8C8P6
EMT30659 XP_020154545.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]