SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT30738 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT30738
Domain Number 1 Region: 239-308
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000589
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number 2 Region: 156-211
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000647
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT30738
Sequence length 313
Comment pep:novel supercontig:GCA_000347335.1:Scaffold5605:4203:7852:1 gene:F775_25091 transcript:EMT30738 description:"Uncharacterized protein "
Sequence
MRFHALGKPLVRCCHHSSRLEERRKDEDQDAAWSQKDVVFSGFALHGTPPPGPGATSPFR
PALRQVKETFGAFYSEKLQVSLSLSQVIPERFVNYFAWKLSGTIELEAPNGEDSPYEHES
SESDDHTLPTPLYVLSGKCYVTEEDDANIVELVQEIQPEMPSLVAMMTKPSAKPYPDVVI
PKDYALAHFPRKNQTIKLQLPEQSKKWYCEFHNPYMMAMGAELTEVQDKIVLEKVGAIAS
DLPIYVAVMTKTNVRVSLTFGTEYAAKYLRKGDRNLVLQQWHGVMRDHKGALRISGGWTS
FASENGLTSASSS
Download sequence
Identical sequences M8C9G0
EMT30738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]