SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT30840 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT30840
Domain Number 1 Region: 159-277
Classification Level Classification E-value
Superfamily Mannose-binding lectins 5.23e-33
Family Mannose-binding lectins 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT30840
Sequence length 287
Comment pep:novel supercontig:GCA_000347335.1:Scaffold5365:54968:56196:-1 gene:F775_18449 transcript:EMT30840 description:"Uncharacterized protein "
Sequence
MANFQITPRAAFVESNELNFRSLYLFHTPLGSNQNQSGIIDSNVTTGLGATVVNNWPICD
GPSTGATIVARAQGLHIYAGNWQNTFSITFEVERFKGSTLQVMGISVEEGEWAIVGGTGQ
FAMATGVIYKKFHEQRSDGNIIELTVHGFCPMLKGSQSLPTKVGPWGGNGGSDKDIVKAP
RRLESITVSRGTIIDSIKFSYVDQAGPKRTVGPWGGSGGKQNTFVLGTSEFVKEVSGTFG
LYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVVELSRQMSSC
Download sequence
Identical sequences M8C0Q2
EMT30840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]